Research LibraryGLP-2 (Glepaglutide)
    Recovery

    GLP-2 (Glepaglutide)

    GLP-2 is an intestinotrophic hormone of the glucagon family, and glepaglutide is a long-acting analogue studied in clinical research for its association with intestinal mucosal growth and improved nutrient absorption.

    Key Mechanisms

    Agonist at the GLP-2 receptor (GLP-2R)Associated with intestinal crypt-cell proliferation and villus growthStudied for increased intestinal absorptive surface areaLinked to enhanced mucosal blood flow and reduced epithelial apoptosisLong-acting analogues engineered to resist DPP-4 degradation

    Research Use Only

    For research use only. Not intended for human consumption, diagnosis, treatment, or prevention of disease. The information on this page is provided for educational and laboratory reference purposes only.

    Quick Facts

    Peptide nameGLP-2 (Glepaglutide)
    Research categoryRecovery
    Molecular formulaC₁₆₄H₂₅₂N₄₄O₅₂S (GLP-2)
    Molecular weightGLP-2 ≈ 3766 g/mol
    SequenceGLP-2: HADGSFSDEMNTILDNLAARDFINWLIQTKITD (33 residues); glepaglutide: stabilized GLP-2 analogue
    Primary research interestGLP-2 receptor signaling and intestinal-adaptation (mucosal growth) research
    Storage considerationsLyophilized powder stored frozen at −20 °C; reconstituted solution refrigerated at 2–8 °C and protected from light.
    Solubility notesSoluble in sterile or bacteriostatic water; native GLP-2 is rapidly degraded by DPP-4, which long-acting analogues are designed to resist.
    Related compoundsTeduglutide, Semaglutide, Larazotide Acetate

    Introduction

    Research Use Only

    GLP-2 and its analogues are discussed here strictly as investigational research compounds for educational and laboratory reference. This is not guidance for human use, diagnosis, treatment, or prevention of disease.

    Glucagon-like peptide-2 (GLP-2) is a 33-amino-acid intestinotrophic hormone of the glucagon/secretin superfamily, secreted by intestinal L-cells alongside its better-known sibling GLP-1. Where GLP-1 research centers on glucose and appetite, GLP-2 research centers on the growth and maintenance of the intestinal lining — making it a defining molecule in the study of intestinal adaptation and recovery.

    Glepaglutide is a long-acting synthetic GLP-2 analogue engineered to resist the rapid enzymatic degradation that limits the native hormone. It belongs to the same class as teduglutide, an established GLP-2 analogue studied for short bowel syndrome. Together these compounds illustrate the research strategy of converting a short-lived gut hormone into a durable tool for studying mucosal growth, a theme catalogued across the peptide database.

    This profile covers what GLP-2 is, the structural modifications that make analogues like glepaglutide long-acting, its GLP-2 receptor mechanism, the intestinal-adaptation research it appears in, and how it compares with related compounds including teduglutide and the barrier-focused peptide Larazotide Acetate. It is one of the more clinically studied recovery peptides in this catalogue.

    What is GLP-2 (Glepaglutide)?

    GLP-2 is a proglucagon-derived peptide released from intestinal L-cells in response to nutrient intake. Its principal documented role is intestinotrophic — it promotes growth and maintenance of the intestinal epithelium, increasing the absorptive surface area of the gut. Native GLP-2, however, is rapidly inactivated by the enzyme dipeptidyl peptidase-4 (DPP-4), giving it a half-life of only minutes and limiting its usefulness as a research or therapeutic tool.

    Glepaglutide is a synthetic GLP-2 analogue designed to overcome that limitation through sequence modifications that increase stability and prolong activity. It has been studied in clinical research, including trials in short bowel syndrome — a condition of inadequate intestinal absorption — where increasing absorptive capacity is the central goal. This places glepaglutide in the same research lineage as teduglutide, the first GLP-2 analogue to be developed for that setting.

    At a glance

    Class: glucagon-family intestinotrophic peptide (GLP-2) and its long-acting analogue glepaglutide. Receptor: GLP-2 receptor (GLP-2R). Research focus: intestinal mucosal growth, absorptive surface area, short bowel syndrome. Key limitation of native peptide: rapid DPP-4 degradation, addressed by analogue design.

    Molecular and structural characteristics

    Native GLP-2 is a linear 33-residue peptide that, like other members of the glucagon/secretin family, adopts a helical conformation when engaging its receptor. A key vulnerability lies at its N-terminus, where DPP-4 cleaves the peptide and inactivates it — the same enzymatic liability seen with GLP-1 and other incretin-family peptides.

    Long-acting analogues address this through stabilizing modifications. Teduglutide, for example, carries a single amino-acid substitution near the N-terminus that confers DPP-4 resistance, while glepaglutide is engineered with sequence changes that extend its duration further, supporting less frequent administration in research settings. The central design principle across the class is converting a minutes-long signal into a sustained one without losing GLP-2 receptor activity.

    PropertyValue / description
    Peptide classGlucagon-family intestinotrophic peptide / analogue
    Native length33 amino acids (GLP-2)
    OriginProglucagon, secreted by intestinal L-cells
    ReceptorGLP-2 receptor (GLP-2R)
    Native vulnerabilityDPP-4 cleavage at the N-terminus
    Analogue designStabilizing modifications for DPP-4 resistance / long action
    Key physicochemical descriptors

    Mechanism of action

    GLP-2 acts through the GLP-2 receptor (GLP-2R), a G-protein-coupled receptor expressed on specific cell populations in the intestine, including enteroendocrine cells, subepithelial myofibroblasts, and enteric neurons. Notably, GLP-2R is not expressed directly on the absorptive enterocytes that proliferate; instead, receptor activation triggers release of downstream mediators — including insulin-like growth factor-1 (IGF-1), keratinocyte growth factor, and other trophic and vascular signals — that drive the observed mucosal effects.

    Through this indirect, mediator-driven mechanism, GLP-2 is associated with crypt-cell proliferation and villus growth, expanding the intestinal absorptive surface. It is additionally studied for reduced epithelial apoptosis, enhanced mucosal blood flow, and effects on barrier function and gut motility. The net research theme is intestinal adaptation — the gut's capacity to remodel and increase its absorptive capacity.

    This mechanism contrasts instructively with that of its relative GLP-1: both are proglucagon-derived and engage GPCRs, but GLP-1 receptor agonists are studied for glucose and appetite, whereas GLP-2 is studied for gut tissue growth. It also contrasts with barrier-focused peptides like Larazotide Acetate, which regulate permeability rather than promote growth.

    • Agonism at the GLP-2 receptor on non-enterocyte intestinal cells.
    • Release of downstream mediators (IGF-1, KGF) that drive mucosal growth.
    • Stimulation of crypt-cell proliferation and villus elongation.
    • Reduced epithelial apoptosis and enhanced mucosal blood flow.
    • Net expansion of intestinal absorptive surface area.

    Intestinal-adaptation and absorption research

    The flagship research context for GLP-2 analogues is short bowel syndrome, a condition in which loss of functional intestine leaves study populations dependent on parenteral nutrition. Because GLP-2 expands absorptive surface area, analogues such as teduglutide and glepaglutide have been studied for their association with reduced dependence on parenteral support — a direct readout of improved intestinal absorption.

    Glepaglutide specifically has been examined in clinical trials as a long-acting option intended to allow less frequent administration than earlier analogues. The broader research theme — harnessing an endogenous intestinotrophic hormone to drive gut adaptation — connects GLP-2 to the wider study of recovery-focused peptides catalogued in the peptide database.

    Evidence caveat

    GLP-2 analogue research has focused on specific study populations, particularly short bowel syndrome. Results are dependent on study design and population, and are described here as research observations rather than outcomes for any individual.

    Gut-recovery and trophic research

    Beyond short bowel syndrome, the intestinotrophic biology of GLP-2 makes it a subject of broader gut-recovery research. Preclinical work has examined GLP-2 in contexts involving mucosal injury and the maintenance of barrier integrity, on the rationale that a healthier, better-developed epithelium supports both absorption and barrier function.

    It is important to distinguish GLP-2's growth-promoting action from the barrier-sealing action of permeability regulators. Where Larazotide Acetate is studied for closing tight junctions, GLP-2 is studied for expanding and maintaining the absorptive tissue itself. This trophic property also underlies a key cautionary theme in the research: agents that promote cell proliferation warrant careful study of growth-related risks.

    Comparison: GLP-2 (Glepaglutide) vs Teduglutide vs Semaglutide

    GLP-2 analogues are best understood alongside teduglutide, the established GLP-2 analogue, and semaglutide, a GLP-1 analogue — a comparison that highlights how two proglucagon-derived peptides diverge in function.

    CompoundReceptor targetClassMain research context
    GlepaglutideGLP-2 receptorLong-acting GLP-2 analogueShort bowel syndrome, intestinal adaptation
    TeduglutideGLP-2 receptorGLP-2 analogue (DPP-4 resistant)Short bowel syndrome
    SemaglutideGLP-1 receptorGLP-1 analogueGlycemic regulation and body weight
    Proglucagon-family peptide comparison (research framing)

    Teduglutide and glepaglutide share the GLP-2 receptor and the goal of intestinal growth, differing mainly in duration of action, while Semaglutide acts on the GLP-1 receptor for entirely different endpoints. Full entries for related compounds are in the peptide database.

    Half-life and pharmacokinetic considerations

    Native GLP-2 has a half-life of only minutes, owing to rapid DPP-4 cleavage at its N-terminus — the same kinetic limitation seen across the incretin/proglucagon family. This brevity is what made the native hormone impractical and motivated the development of stabilized analogues.

    Glepaglutide is engineered for a substantially longer duration of action, supporting less frequent administration in research, while teduglutide occupies an intermediate position. As with other analogue classes, findings from a long-acting analogue should not be assumed to apply identically to the native peptide, so the literature distinguishes carefully between them.

    Reconstitution and handling considerations

    Lyophilized GLP-2 or glepaglutide is reconstituted with sterile or bacteriostatic water, added slowly down the vial wall and swirled gently rather than shaken to protect the peptide. The resulting solution should be clear; cloudiness or particulates indicate it should be discarded.

    Working concentrations are selected so research volumes are convenient and reproducible. The reconstitution calculator and reconstitution guide describe the general method.

    • Add diluent slowly; swirl gently rather than shaking.
    • Confirm the solution is clear before use.
    • Protect from light and excess warmth.
    • Avoid repeated freeze–thaw cycles of reconstituted material.

    Storage considerations

    Lyophilized GLP-2 / glepaglutide is most stable frozen at −20 °C, kept dry and away from light. Once reconstituted, it is refrigerated at 2–8 °C and used within a limited window; aliquoting reduces how often a given solution is cycled through freeze–thaw.

    FormConditionNotes
    Lyophilized powder−20 °C, dark, dryMost stable for long-term holding
    Reconstituted solution2–8 °C, protected from lightUse within a limited window
    Freeze–thawAvoid repeated cyclesAliquot to minimize cycling
    Storage summary

    Research limitations

    GLP-2 analogues are research compounds whose clinical study has concentrated on short bowel syndrome and intestinal adaptation. Because the mechanism is fundamentally growth-promoting, the research emphasizes careful evaluation of proliferation-related risks, and findings in specific study populations cannot be generalized. Native GLP-2's very short half-life further means results are highly form- and analogue-dependent. It is described here strictly for research reference.

    • Clinical research has focused mainly on short bowel syndrome.
    • The trophic (growth-promoting) mechanism warrants careful risk evaluation.
    • Results are strongly analogue- and form-dependent (native vs long-acting).
    • It is not an approved therapy in this context and is described solely for research reference.

    Research Use Only

    This profile is for educational and laboratory reference. GLP-2 and glepaglutide are not intended for human consumption, diagnosis, treatment, or prevention of disease.

    Frequently Asked Questions

    What is GLP-2 (glepaglutide)?

    GLP-2 is a 33-amino-acid intestinotrophic hormone from intestinal L-cells that promotes growth of the gut lining. Glepaglutide is a long-acting synthetic GLP-2 analogue engineered to resist enzymatic degradation, studied in clinical research including trials in short bowel syndrome.

    How does GLP-2 work?

    GLP-2 activates the GLP-2 receptor on non-enterocyte intestinal cells, which then release downstream mediators such as IGF-1 and keratinocyte growth factor. These mediators drive crypt-cell proliferation, villus growth, reduced epithelial apoptosis, and enhanced mucosal blood flow, expanding absorptive surface area.

    Why is GLP-2 studied in short bowel syndrome?

    Short bowel syndrome involves inadequate intestinal absorption. Because GLP-2 analogues expand absorptive surface area, they have been studied for their association with improved absorption and reduced dependence on parenteral nutrition in affected study populations.

    How is glepaglutide different from teduglutide?

    Both are GLP-2 receptor analogues developed for intestinal adaptation. They differ mainly in duration of action — glepaglutide is engineered as a longer-acting option intended to allow less frequent administration than earlier analogues such as teduglutide.

    How is GLP-2 different from GLP-1 peptides like semaglutide?

    Both are proglucagon-derived and act through G-protein-coupled receptors, but GLP-2 targets the GLP-2 receptor to promote intestinal growth, while GLP-1 agonists like semaglutide target the GLP-1 receptor for glycemic and appetite endpoints.

    References

    1. Drucker DJ, Yusta B. Physiology and pharmacology of the enteroendocrine hormone glucagon-like peptide-2. Annu Rev Physiol. 2014.Source
    2. Naimi RM, et al. Glepaglutide, a novel long-acting glucagon-like peptide-2 analogue, for patients with short bowel syndrome: a randomised phase 2 trial. Lancet Gastroenterol Hepatol. 2019.Source
    3. Jeppesen PB, et al. Teduglutide reduces need for parenteral support among patients with short bowel syndrome with intestinal failure. Gastroenterology. 2012.Source

    Research Use Only

    For research use only. Not intended for human consumption, diagnosis, treatment, or prevention of disease. The information on this page is provided for educational and laboratory reference purposes only.

    See the database summary for GLP-2 (Glepaglutide)

    Quick benefits, category tags, and sourcing links.